PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 349aa    MW: 39967.4 Da    PI: 6.1381
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596496.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++++G g+W+t ++  g+ R++k+c++rw +yl
   XP_013596496.1 14 KGPWTSEEDQKLIEYIQKHGYGNWRTLPNNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding521.7e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
   XP_013596496.1  67 RGRFSFEEEETIIKLHSFLGNK-WSAIAARLP-GRTDNEIKNFWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-26564IPR009057Homeodomain-like
PROSITE profilePS5129424.793965IPR017930Myb domain
SuperFamilySSF466893.52E-3111108IPR009057Homeodomain-like
SMARTSM007174.9E-131363IPR001005SANT/Myb domain
PfamPF002493.4E-161461IPR001005SANT/Myb domain
CDDcd001673.62E-121661No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2665117IPR009057Homeodomain-like
PROSITE profilePS5129419.21466116IPR017930Myb domain
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002498.2E-1567111IPR001005SANT/Myb domain
CDDcd001671.59E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGRSPCCEKN GLKKGPWTSE EDQKLIEYIQ KHGYGNWRTL PNNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIK LHSFLGNKWS AIAARLPGRT DNEIKNFWNT HIRKKLIRMG  120
IDPVTHSPRL DLLDISTILA SSLYNSSSHE SHHVNMSTLM MDAHRQQQQY PLVNPEILKL  180
ATSLFSQNQT QNYMVDHDSS THENHTGYHN DVNQTGVNQY QTDHQELQSC LPPFPNEAQF  240
NNMDYRFNGF GEHTLVSTSN TLVQDCNIPT FNDYESSSFV LDPSYSDQSF NFTNSVLNTP  300
SSSPTTLNSC STTYINSTSC TTEDEMESYC NNLMKFDIPD FLDICGVII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410200.0AC241020.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039B11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596496.10.0PREDICTED: transcription factor MYB51-like
TrEMBLA0A0D3DF940.0A0A0D3DF94_BRAOL; Uncharacterized protein
STRINGBra038774.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.10.0MYB-like 102